SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008622 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008622
Domain Number 1 Region: 390-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.47e-42
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00099
Further Details:      
 
Domain Number 2 Region: 6-85
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000135
Family Domains B1 and B5 of PheRS-beta, PheT 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008622   Gene: ENSTTRG00000009082   Transcript: ENSTTRT00000009092
Sequence length 589
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2279:149330:216979:-1 gene:ENSTTRG00000009082 transcript:ENSTTRT00000009092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTVSLKRDLLFRALGRTYTDEEFDELCFEFGLELDEITSEKEIISKEQGNEKAQGASDV
VLYKIDVPANRYDLLCLEGLVRGLQVFKERIKAPMYKRVMPNGEIQKLIITEETAKIRPY
AVAAVLRNIKFTKDRYESFIELQEKLHQNICRKRALVAIGTHDLDTLSGPFTYTAKKPSD
IKFKPLNKTKEYTACELMNIYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXH
HSKITVNTRNIFIECTGTDFTKAKIVLDIIVTTFSEYCENQFTVEAAEVVFPNGKLHTFP
ELAYRKEMVRADLINKKVGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFPLNKLTELLRHDMAAAGFTEALTFALCSQ
EDIADKLGLDISATKAVLISNPKTAEFQVARTTLLPGLLKTIAANRKMPLPLKLFEISDI
VIKDSSRDVGARNYRHLCAVYYNKNPGFEIIHGLLDRLMQLLDVPPGEKKGGYVIKASEG
PAFFPGRCAEIFARGQSIGKLGVLHPDVITKFELTMPCSCVEINIEPFL
Download sequence
Identical sequences ENSTTRP00000008622 ENSTTRP00000008622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]