SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008624 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008624
Domain Number 1 Region: 214-354
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.9e-25
Family Voltage-gated potassium channels 0.0045
Further Details:      
 
Domain Number 2 Region: 57-88,138-196
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-23
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008624   Gene: ENSTTRG00000009098   Transcript: ENSTTRT00000009094
Sequence length 426
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_360:163216:576335:1 gene:ENSTTRG00000009098 transcript:ENSTTRT00000009094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPSASRERPVHRAGVAAPDLLDPKTAAQNSKPRLSFSTKPTVLASRVETDTTINVMKWK
TVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHACVNSTELDELIQQ
IVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALL
GIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVAL
PAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYF
AAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATS
IKRKLSAELAGNHNQELTPCRRTLSVNHLASERDVLPPLLKTESIYLNGLTPHCAGEEIA
VIENIK
Download sequence
Identical sequences ENSTTRP00000008624 ENSTTRP00000008624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]