SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008625 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008625
Domain Number 1 Region: 76-218
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.39e-42
Family Regulator of G-protein signaling, RGS 0.0000000902
Further Details:      
 
Domain Number 2 Region: 785-866
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.51e-27
Family DIX domain 0.0000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008625   Gene: ENSTTRG00000009104   Transcript: ENSTTRT00000009095
Sequence length 866
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3148:9101:47344:-1 gene:ENSTTRG00000009104 transcript:ENSTTRT00000009095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPISHSFCSGKGAGIKGETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDFWFA
CSGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKDCIMKQQIDPA
MFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKLCSDQSSGSGTGKGVPGYLPT
LNEDEEWKCDQDVDEDDGRDPAPPGRLTQKLLLETAAPRASSSRRYSEGREFRYGSWREP
VNPYYVNSGYALAPATSANDSEQQSLSSDADSLSLTDSSVDGVPPYRIRKQHRREMQESV
QVNGRVPLPHIPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEE
EGEDGDVSSGPPGASHKLPSAPAWHHFPPRYADVSCVGLRDAHEENPESILDEHVQRVMR
TPGCQSPGPGHRSPDSAHMPKMGALGGTVPGHGKHVPKSGAKLDTAGLHLHRHGHHHGHH
GSARPKEPAEAEASRRVQSSFAWGPELHGHAAKPRSHVESMGAAPTTSDSLAYSGKASMT
SKRNSKKAESGKSTSVEAPGPSEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGAKKQQA
HESSRPLSIERPGAVHPWVSAQLRTSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLEE
EEKRASKAPSRQRYVQEVIQRGRSCVRPACTPVLSVVPAVSDLELSETETKSQRKAGGGS
AQSCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGNYRYYFKKVSDEFECGVV
FEEVREDGAVLPVFEEKVIGKVEKVD
Download sequence
Identical sequences ENSTTRP00000008625 ENSTTRP00000008625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]