SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008656 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008656
Domain Number 1 Region: 36-345,449-489
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.11e-73
Family FAD-linked reductases, N-terminal domain 0.00000000218
Further Details:      
 
Domain Number 2 Region: 325-435
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.18e-35
Family L-aminoacid/polyamine oxidase 0.00000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008656   Gene: ENSTTRG00000009085   Transcript: ENSTTRT00000009129
Sequence length 555
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3257:42375:154114:-1 gene:ENSTTRG00000009085 transcript:ENSTTRT00000009129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLAEALVRGGSAAGEDRVPDTGAAGTEVARRGTSNMSSKCDVVVVGGGISGMTAAKLLHD
SGLNVIVLEARDRVGGRTYTIRNQKVKYVDLGGSYVGPTQNRILRLSKELGLETYKVNEV
ERLIYHVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPSDAPWKAPLAEQWDH
MTMKELLDKICWTESSKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGSARIISTTNGG
QERKFVGGSGQVSERIMDLLGDRVKLERPVIHIDQTGENVLVETLNHEVYEAKYVISAIP
PVLGMKIHFSPPLPMMRNQLITRVPLGSVIKCIVYYKEPFWRNKDYCGSMIIEGEEAPVA
YTLDDTKPDGSYAAIIGFILAHKARKLTRLTKEERLKKLCDLYAKVLGSQEALHPVHYEE
KNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVGRIYFAGTETAAHWSGYMEGAVEAGER
AAREILHAMGKIPEDEIWQPEPESVDVPAKPITTTFLERHLPSVPGLLRLIGLTTILSAT
ALGYLAHKRGLLVRV
Download sequence
Identical sequences ENSTTRP00000008656 ENSTTRP00000008656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]