SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008659 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008659
Domain Number 1 Region: 1043-1206
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.45e-45
Family BCR-homology GTPase activation domain (BH-domain) 0.0000773
Further Details:      
 
Domain Number 2 Region: 1-67
Classification Level Classification E-value
Superfamily Bcr-Abl oncoprotein oligomerization domain 7.06e-35
Family Bcr-Abl oncoprotein oligomerization domain 0.0000184
Further Details:      
 
Domain Number 3 Region: 700-770,828-863
Classification Level Classification E-value
Superfamily PH domain-like 7.71e-17
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 4 Region: 904-1006
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000151
Family Synaptotagmin-like (S variant) 0.025
Further Details:      
 
Domain Number 5 Region: 580-653
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000000051
Family DBL homology domain (DH-domain) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008659   Gene: ENSTTRG00000009120   Transcript: ENSTTRT00000009132
Sequence length 1260
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_488:144165:232792:1 gene:ENSTTRG00000009120 transcript:ENSTTRT00000009132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQ
TLLAKEKKSYDRQRWGFRRAAQPPDGAAEPRAPRPQPAPADCADPPPADEPEARLDGEGS
PGKARPTATRRPGAAAPADHDDRGPPTSVAALRSNFERIRKGPVQPAATDAEKPFYVNVE
FHHERGLVKVNDKDVSDRISSLGRQARQMERKKSQQGAGPAPGDPPRLSYRGRLSESSCG
LDGDFEDAELNPRFMKDNLINANGGSRPPWPPLEYQPYQSIYVGGMMVEGEGKGSLQRSQ
STSEQEKRLTWPRRSYSPRSFEDSGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RTFRDKSRSPSQNSQQSFDSSSPPTPQCQKRHRQGPVVVSEATIVGVRKTGQIWPSDGDG
AFHGDADAPFGTPPGYGCATDRAEEQRRHQDGLPYMDDSPSSSPHLGSKGRGSRDAPEST
KVSELDLEKGSEMRKWVLSGILASEETYLSHLEALLLXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASQLGVYRAFVDNYGVAMETA
EKCCQANAQFAEISENLRARSNKDAKDQTTKNSLETLLYKPVDRVTRSTLVLHXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHRQLLKDSFMVELVEGARKL
RHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQTVDDAEATPNIPLVLDEELD
AMKIKISQIKSDIQREKRANKGSKAIERLRKKLSEQESLLLLMSPSMAFRVHSRNGKSYT
FLISSDYERAEWRENIREQQKKCFKSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDE
SPGLYGFLNVIVHSATGFKQSSSLYCTLEVDSFGYFVKAKTRVYRDTGEPNWNEEFEIEP
EGSQTLRILYEKCYNKSKITKEDGESADRIMGKGQVQLDPQALQDRDWQRTIIAMNGIEV
KLSVKFTSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVG
IYRVSGVATDIQALKAAFDVNNDVSMMSEMDVNAIAGTLKLYFRELEPFTDEFYPNFAEG
IALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKETVNKMSLHNLATVFGPTL
LRPSDKESKLPPNPSQPISMTDSWSLEVMSQVQVLLYFLQLEAIPAPDSKRQSILFSTEV
Download sequence
Identical sequences ENSTTRP00000008659 ENSTTRP00000008659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]