SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008675 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008675
Domain Number 1 Region: 2-269
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.56e-54
Family BAR domain 0.00000000522
Further Details:      
 
Domain Number 2 Region: 461-601
Classification Level Classification E-value
Superfamily PH domain-like 2.27e-25
Family Phosphotyrosine-binding domain (PTB) 0.0075
Further Details:      
 
Domain Number 3 Region: 300-355
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000976
Family Pleckstrin-homology domain (PH domain) 0.0000566
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008675   Gene: ENSTTRG00000009144   Transcript: ENSTTRT00000009149
Sequence length 680
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1741:149522:172106:1 gene:ENSTTRG00000009144 transcript:ENSTTRT00000009149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQXXXXXXXXXXXKLLKEYENQRFPLGGD
DEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKERDLKXXXXXXXXXXXXXX
XHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLE
PLLGYMQAQISFFKMGSENLNDQLEEFLTNIGTSVQNVRREMDSDVETMQQTIEDLEVAS
DPLYVPDPDPTKFPVNRNLTRKAGYLNARXXXXXXXXXXXXXXXXXXXXXXXSQARGDVA
GGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESKKDHEEWICTINNISKQIY
LSENPEEIAARVNQSALEAVTPSPSFQQRHESLRPAGQSRPLTARTSSSGSIGSEPTNLA
ALSLDSLVAPDTPIQFDIISPVCEDQPGQAKASGQGGRRTNPFGESGGGTKSETEDSILH
QLFIVRFLGSMEVKSDDNPDVVYETMRQILAARAIHNIFRMTESHLLVSCDCLKLIDPQT
QVTRLMFPLPSVVLYATHQENKRLFGFVLRTSGGRSESNLSSVCYIFESNNEGEKICDSV
GLDRRASEKQKEIERVKEKQQKELSKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLS
SSQSEESDLGEEGKKRESEA
Download sequence
Identical sequences ENSTTRP00000008675 ENSTTRP00000008675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]