SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008725 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008725
Domain Number 1 Region: 5-324,437-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-47
Family FAD-linked reductases, N-terminal domain 0.00056
Further Details:      
 
Domain Number 2 Region: 310-419
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.14e-21
Family L-aminoacid/polyamine oxidase 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008725   Gene: ENSTTRG00000009205   Transcript: ENSTTRT00000009201
Sequence length 475
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_88:312600:316108:1 gene:ENSTTRG00000009205 transcript:ENSTTRT00000009201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVEGSERLGGWIRSVRGPDGAVFELGPRG
IRPAGVLGARTLLMVSELGLDSEVLPVRGDHAAAQNRFLYVGGTLHALPSGIRGLLRPSP
PFSKPLFWAGLKELTTPRGKDPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSILLGLLLGAGPQPDSALIRQARAERWSQWSLRGGLETLPQALNT
HLTSRGVSVLRGQPVCGLSLEAEGCWKVSLGDSNLEADHIISAIPASVLSKLLPAEAAPL
ARALSTITAVSVAVVNLQYRGARLPVQGFGHLVPSSEDPGILGIVYDSVAFPEQDGSPPG
LRVTVMLGGSWLRTLEARGSVLSQELFQKEAEKAAATSLGLKEPPSHCLVHLHKNCIPQY
TLGHWQKLESATQFLAAQKLPLTLAGASYEGVAVNDCIESGRQAAARVLGTEPNS
Download sequence
Identical sequences ENSTTRP00000008725 ENSTTRP00000008725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]