SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008778 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008778
Domain Number 1 Region: 12-225
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.26e-59
Family Proteasome subunits 0.000000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008778   Gene: ENSTTRG00000009256   Transcript: ENSTTRT00000009256
Sequence length 273
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1625:188007:190400:-1 gene:ENSTTRG00000009256 transcript:ENSTTRT00000009256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKTAPEPQKGFSFENCERNAALERSLPGLRVPHARKTGTTIAGLVFRDGVILGADTRAT
NDSIVAYQSCEKIHFIAPKIYCCGAGVAADAEMTTRMAASNMELHALSTGREPRVATVTR
ALRQTLFRYRGYVGASLIVGGVDFTGPQLYCVHPHGSYSRLPFTAQGSGQDAALAVLEDR
FQPNMTLEAAQELLVEAITAGILGDLGSGGSVDACVITGTSAKLLRTLSSPTEPIERSSQ
YRFAPGTTAVLSETVMPLTLELLEETVQAMDVE
Download sequence
Identical sequences ENSTTRP00000008778 ENSTTRP00000008778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]