SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008788 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008788
Domain Number 1 Region: 70-200
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.54e-46
Family Regulator of G-protein signaling, RGS 0.00000856
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008788   Gene: ENSTTRG00000009269   Transcript: ENSTTRT00000009267
Sequence length 211
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_950:48869:51488:1 gene:ENSTTRG00000009269 transcript:ENSTTRT00000009267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSAMFLAVQHDCGPMDKSAGTGPKSEEKREKMKRTLXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXQTFTKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKAKKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQITTEPHAT
Download sequence
Identical sequences ENSTTRP00000008788 ENSTTRP00000008788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]