SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008801 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000008801
Domain Number - Region: 406-443
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0698
Family Troponin I 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008801   Gene: ENSTTRG00000009286   Transcript: ENSTTRT00000009281
Sequence length 484
Comment pep:known_by_projection scaffold:turTru1:scaffold_112520:287106:865203:1 gene:ENSTTRG00000009286 transcript:ENSTTRT00000009281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERSGQRTTTWDCDQGKQSDSDYREDGMDLGSDAGSSSSSSRASSQSNSTKVTPCSECKS
SPSPGGSLDLVSALEGYEEPFPVYQKKVIDEWAPEEDAEKEDEEERSERGYRDDRCPAQE
PGDVSARTRSGGGRGATTAMPPPVPNGNLHPHDPQDLRHNGNVVVASRPSGSRGPRRAVQ
KPQPAGGRRGGRGPAAGSLCLQPTDSGTCVPEEPPVPPMDWEALEKHLAGLQFREQEVRN
QGQARTNSTSAQKNERESIRQKLALGSFFDDGPGIYTSCSKSGKPSLSSRLQSGMNLQIC
FVNDSGSDKDSDADDSKTETSLDTPLSPMSKQSSSYSDRDTTEEESESLDDMDFLTRQKK
LQAEAKMALAMAKPMAKMQVEVEKQNRKKSPVADLLPHMPHISECLMKRSLKPTDLRDMT
IGQLQVIVNDLHSQIESLNEELVQLLLIRDELHTEQDAMLVDIEDLTRHAESQQKHMAEK
MPAK
Download sequence
Identical sequences XP_004281894.1.21590 ENSTTRP00000008801 ENSTTRP00000008801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]