SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008836 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008836
Domain Number 1 Region: 1373-1436,1470-1650
Classification Level Classification E-value
Superfamily VPS9 domain 3.01e-41
Family VPS9 domain 0.0021
Further Details:      
 
Domain Number 2 Region: 13-195
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.96e-25
Family Regulator of chromosome condensation RCC1 0.0068
Further Details:      
 
Domain Number 3 Region: 519-617
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.8e-25
Family beta-lactamase inhibitor protein-II, BLIP-II 0.051
Further Details:      
 
Domain Number 4 Region: 1042-1131
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 4.18e-24
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0093
Further Details:      
 
Domain Number 5 Region: 1136-1223
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0000000000000131
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.024
Further Details:      
 
Domain Number 6 Region: 922-1008
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000123
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 7 Region: 687-886
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000000275
Family DBL homology domain (DH-domain) 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008836   Gene: ENSTTRG00000009317   Transcript: ENSTTRT00000009317
Sequence length 1652
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_353:241500:311108:-1 gene:ENSTTRG00000009317 transcript:ENSTTRT00000009317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKKKSSTEAEGSKERGLVHVWQAGSRSVTPERLPGWGGKTVLHAALGVKHGVLLTEDG
EVYSFGTLPWRSEPAEICPSSPILEEVLVGQYVVTVATGSFHNGAVTESGVVYMWGENSA
GQCAVANQQYVPEPNPVSISDSETSPLLAVRILQLACGEEHTLALSLSREICSWVTGCQL
GLITTTFPVILPQNVEHHVGRVLLPVAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXIISDSHCCTGVTLSSQSEQASTAIPSTETVDGKGEVFENTVQNELRAATEL
NVGNVQTTSVETISSPQDVMGTPEISSARSISSYPDTQAVNEYVQKLSDHSVRENSENGE
KPVPSQPLVAEAIPNLHSPATTSTSALNSLVVSCASAVGVRVAATYEAGTLSLKKVMNFY
STAPCEPGAQAGSSPIGPEGLKDSREEQVKQESMQGKKSSSLVDIREEESEGGSRRLSLP
GLLSQVSPRLLRKAARVKTRTVVLTPTYSGEADALLPSLRTEVWTWGKGKEGQLGHGDVL
PRLQPLCVKCLDGKEVIHLEAGGYHSLALTAKSQVYSWGSNTFGQLGHSDFPTTVPRLVK
VNSENGVWSVAAGQDYSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XLGYISRVTAGKDSYLALVDKNIMGYIASLHELATTERQFYSKLSDIKSQILRPLLSLXX
XXXXXXXXXLQEVASRFSKLCYLIGQHGTSLSSFLQGIKEARSLVILKHASLFLDSYTEY
CTSITNFLVMGGFQLLAKPAIDFLNKNQELLQDLSEVNDENTQLMEILNTLFFLPIRRLH
NYAKVLLKLATCFEVTSPEYQKLQDSSSCYESLALHLGRKRKEAEYTLGFWKTFPGKMTD
SLRKPERRLLCESSNRALSLQHAGRFSVNWFILFNDALVHAQFSTHHVFPLATLWAEPLS
EEAGGVNGLKITTPEEQFTLISSTPQEKTKWLRAISQAVDQALRGMSDFPPYGSGSSIQR
QEPPISRSAKYTFYKDPRLKDATYDGRWLSGKPHGRGVLKWPDGKIYSGMFRNGLEDGYG
EYRIPNKALNKEDHYVGHWKEGKMCGQGVYSYASGEVFEGCFQDNMRHGHGLLRSGKLTS
SSPSMFIGQWVMDKKAGYGVFDDITRGEKYMGMWQDDVCQGNGVVVTQFGLYYEGNFHLN
KMMGNGVLLSEDDTIYEGEFSDDWTLSGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXRKLGNLAVPADEKWKAVFDECWHQLGCENPGQGEVWKAWDNIAVAL
TTSRRQHRDSPEILSRSQTQTLESLEFIPQHIGAFSVEKYDDIKKYLIKACDTPLHPLGR
LVETLVAVYRMTYVGVGANRRLLQEAVKEITSYLKRIFQLVRFLFPELPEEGTTIPLSAP
LPTERKSFCTGKSDSRSESPEPGYVVTGSGLLLPVLLPRLYPPLFMLYALDNDREEDVYW
ECVLRLNKQPDIALLGFLGVQRKFWPVTLSILGESKKVLPTTKDACFASAVECLQQISTT
FTPSDKLKVIQQTFEEISQSVLASLQEDFLWSMDDLFPVFLYVVLRARIRNLGSEVHLIE
DLMDPYLQHGEQGIMFTTLKACYYQIQREKLN
Download sequence
Identical sequences ENSTTRP00000008836 ENSTTRP00000008836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]