SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008846 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008846
Domain Number 1 Region: 928-1010
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-20
Family SH3-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008846   Gene: ENSTTRG00000009320   Transcript: ENSTTRT00000009328
Sequence length 1011
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_311:91399:195720:-1 gene:ENSTTRG00000009320 transcript:ENSTTRT00000009328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVPVFEDVKDETQEEKTGEEENEEDKVFFKPVIEDLSMELARKCTELISDIHYKEEYKK
SKDKCTFVTDTPMLKHVKRIGAFISEAKYKGTIADLSNSLYKQMPATIDSVFAEVTQLQS
EVAYKQKHDAAKGFSDYAHMKEPPEIKHAMEVNKHQSHIFYRKDVQDTHVYSAELDRPDI
KMATQISKIISNAEYKKGQGVMNKEPAVIGRPDFEHAVEASKLSSQVKYKEKFDNEMKDK
KHHYNPLESASFRQSQLATALASNVKYKKDIQNMHDPVSDLPNLFLNHALKTSKMLSGRE
YRKLFEENKGMYHFDTDAVEHLHHKGNAMLQSQVKYKEEYEKNKGKSMLEFVETPSYQAS
KEAQKMQSEKVYREDFEKEIKGRSSMDLDKTPEFLHVKYITSLLKEEYKKDLENEIKREG
ELNSEVLDIQRAKRASEMASEKEYKKDLESKIKGKGMQVGTDTLGIQHAKRASEIASEKD
YKRDLETEIRGKGMQVSTGTLDIQRAKKASEMASQKEYKKDLENEIKGKGMQVSMDIPDM
LRAKRASEIYSHXKKYKDEAEKMLSSYSTVADTPEIQRIKTTQQNISAVLYKKEVGAGTA
VKDTPEIERVKKNQQNISSVKYKEEMNHGTAISDPPELKRVKENQKNISNLRYKEQCYTA
TPVSTTPEIERVRKNQEQLSTVKYRGEIKQATAISDPPELKRVKENQKNLSNVYYKGQPG
RATALSITPEMERVKKNQENISSVKYTQDQRQMKGRPSLILDTPGLRHVKEAQNHISMVK
YHEDFEKTKGRGFTPVVDDPVTERVRKNTQVVSDAAYKGVHPHIVEMDRRPGIIVEDLKV
WRTDPGSIFDIDPLEDNIQSRSLHMLSEKANHYRRQRSRSHSSSTFGTGLGDDKSEISEI
YPSFSCCSEVTRPSDEGAPVLPGAYQQSHSQGYGYMHQTSLSSMRSMQHSPNLRTYRAMY
DYSAQDEDEVSFRDGDYIVNVQPIDDGWMYGTVQRTGKTGMLPANYIEFVN
Download sequence
Identical sequences ENSTTRP00000008846 ENSTTRP00000008846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]