SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008848 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008848
Domain Number 1 Region: 288-419
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.18e-44
Family Regulator of G-protein signaling, RGS 0.000000161
Further Details:      
 
Domain Number 2 Region: 11-114
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000223
Family DEP domain 0.041
Further Details:      
 
Domain Number 3 Region: 225-279
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0000000000249
Family Transducin (heterotrimeric G protein), gamma chain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008848   Gene: ENSTTRG00000009329   Transcript: ENSTTRT00000009330
Sequence length 663
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3549:125413:190622:1 gene:ENSTTRG00000009329 transcript:ENSTTRT00000009330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTIRHQGQQYRPRMAFLRKIEALVKDMQDPEMGVRVQNQKVAVISVPHAMTXXXXXXXXX
XXXXXXXXXAQNLGNFIVKYGYIYPLQDPKNLVLKPDNSLYRFQTPYFWPTQQWPAEDTD
YAIYLAKRNIKKRGILEEYEKENYNFLNKKINYKWDFVIMQAKEQYRAGKERNKADRYAL
DRQEKAYWLVHRCPPGMNDVLDYGLDRVTDPSEVQVKQKQTVVSVRKEIMYYRQALLRST
VKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWVTDDTQFWDLNAKLVEFPTRMRVERWA
FNFSELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSKVKEKAEEIYKLFLAP
GARRWINIDGKTMDITVKGLKHPHRYVLDAAQTHIYMLMKKDSYARYLKSPVYKEMLARA
VEPQETTKRSSSLRFMRRTLRFSPSPVILRQLEKAKAREAHTVDITQTDQRAAPSPHLTV
YTGAPLPPSPSSPRSPRCRSPRRPFPSPGRFLRRPSSTVCPSPIKVALEGSPGEEPKREA
ARGRSDAETGGASADSRPRAPPKARVALSLGRFLRRGCLASPVFARLSPRCPPVPHGKVQ
PLGEAGRQLPRPRSRRAANFFQIKMDVPTGSGTCLVDPEDTRTGERSDQAIEKEVICPWE
SLR
Download sequence
Identical sequences ENSTTRP00000008848 ENSTTRP00000008848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]