SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008850 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008850
Domain Number 1 Region: 70-206
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.42e-38
Family Regulator of G-protein signaling, RGS 0.00000507
Further Details:      
 
Domain Number 2 Region: 759-839
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.51e-26
Family DIX domain 0.0000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008850   Gene: ENSTTRG00000009332   Transcript: ENSTTRT00000009332
Sequence length 839
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3549:395496:421685:-1 gene:ENSTTRG00000009332 transcript:ENSTTRT00000009332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAVLVPRLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGPVAKPLPVSSNARRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDAKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSVMFDQAQTEIQA
VMEDNAYQMFLTSDIYLEYVRSGGENPACVGGGGLGSLKLVCGYLPTLNEEEEWTCADFK
CKLSPGVGLSSRTLRATVGVRCTETVENGYRSFRRSDPVNPYHVGSGCVFAPATSANDSE
ISSDALTDDSMSMTDSSVDGIPPYLGGNKKQLQREMHRSVKANGQVCLPHFPRTHRLPKE
MTPVEPAAFAAELISRLEKLKLELETRHSLEERLQQIREDEEKEGSELALSAREAGPAQH
PLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRARSPDQHRRHHLLQHRAP
PPPGGPLLPPAAAPAGCPLLGARGFVSRQTTKHVHHHYIHHHAGPXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRRRGGVPPDERESSEPGPAPAREGGAPG
GAGPLQPPGEEGDRAQDVWQWVLESERPGKPKPHSAQSTKRAYPLECARASPAGRHHLWV
GSSGHPRAAPRAHPFTQDPAVPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQQRDR
HHSATGQPGATPFSSPSLASEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRMLKAQ
SLTLGHFKEQLSKKGNYRYYFKKASNEFACGAVFEEVWDDEVVLPTYEGRILGKVERID
Download sequence
Identical sequences ENSTTRP00000008850 ENSTTRP00000008850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]