SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008919 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008919
Domain Number 1 Region: 11-312,342-362
Classification Level Classification E-value
Superfamily Thiolase-like 1.44e-68
Family Thiolase-related 0.0007
Further Details:      
 
Domain Number 2 Region: 449-574,634-732
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 3.4e-42
Family FabD-like 0.0035
Further Details:      
 
Domain Number 3 Region: 1592-1756
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.9e-41
Family Alcohol dehydrogenase-like, C-terminal domain 0.0001
Further Details:      
 
Domain Number 4 Region: 1837-2020
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.36e-31
Family Tyrosine-dependent oxidoreductases 0.00029
Further Details:      
 
Domain Number 5 Region: 1514-1627
Classification Level Classification E-value
Superfamily GroES-like 0.0000000000000572
Family Alcohol dehydrogenase-like, N-terminal domain 0.0059
Further Details:      
 
Domain Number 6 Region: 1197-1357
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0000000367
Family UbiE/COQ5-like 0.044
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000008919
Domain Number - Region: 574-626
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.000615
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008919   Gene: ENSTTRG00000009382   Transcript: ENSTTRT00000009411
Sequence length 2087
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2599:5489:18951:-1 gene:ENSTTRG00000009382 transcript:ENSTTRT00000009411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYGLPRRLGKLKDLSQFDASFFGVHPKQANTMDPQLRLLLEVTYEAIVDGGINPASLRGT
NTGVWVGVSSSEASEALSRDPETLMGYSMVGCQRAMMANRLSFFFDFKGPSVALDTACSS
SLLALQSAYQAIRSGECPAAVVGGINILLKPNTSVQFMKLGMLSPEGSCKSFDAAGDGYC
RAEAVVAVLLTKKSLARRVYATILNAGTNTDGFKEQGVTFPSGEVQEQLIRSLYESAGLT
PESLEYIEAHGTGTKVGDPQELNSIMRALCATRQDPLLIGSTKSNMGHAEPASGLAALIK
VLLSLEHGVWAPNLHFHSPNPEIPALQDGRLQVVDRPLPVLGGNVGINSFGFGGSNVHVI
LRPNAQPPPPPAPHSALPRLLRASGRTLEAVQGLLEQGLRHSHDLAFVSMLNDIAAAPTA
TMPFRGYAVLGGQGGNQEVHQVPAGKRPLWFICSGMGAQWRGMGLSLMRLGSFRDSILRS
DEAVKPLGLQVSDLLLSTDEATFDDTVQSFVSLTAIQIALIDLLTSMGLRPDGIIGHSLG
EVACGYADGCLSQEEAVLAAYWRAQCIKEANIPPGAMAAVGLSEECKRRCPPGIVPACHN
SKDSVTISGPVVLKFVQQLKQEGVFAKEVRTGGIAFHSYFMDSIAPALLQALKKVIREPR
PRSAYWLSTSIPEAQWQGHLARTFSAEYNVNNLVSPVLFQEALRHVPEHAVVLEIAPHAL
LQAILKRGLKSSCTVIPLMKKDHRDNLEFFLGNVGRLHLMGIDINPNGLFPPVEFPAPRG
TPLISPHIRWDHSQTWDVPAMEDFPSGSSRSSATVYKIDASPETPDHYLLDHCIDGRVIF
PATGYLFLVWKTLARALDQNMEQVPVVFEDVTLHQATILPKTGTVPLEVRLLEASCTFEV
SENGNLIVSGQIHQWKDPDPRLFDNQYGTGPTPVDPSAAFHLSQSDVYKELRLRGYNYGP
HFQGILEANLEGNTGRLLWKDNWVTFLDTMLQMSLLVPGHRNLCLPTRITAIHIDPTTHQ
QKLYALQGETQVADVVVXXXXXXXXXXXXXXXXXXXXXAPRRQQEQLAPVLEKFCFTPHV
ESGCLAGSLALQEELQLCRGLAQALQTKVAQQGLKMVVPGLDSAQAPREAPQQGLPRLLA
AACQLQLNGNLQQELGQVLAQERPLLCDDPLLSGLLDSPALKACVDTALENTASLRMKVV
EVLAGDGRLYSRIPALLNTQPLMQLDYIATDRHPQALEATQVKVQQLDLTQVQLEPVDPA
PSSMSRADILVCNCALALGDPTTAVNMAALKEGGFMLLHTLLGGYSLGETVAFLTCSESH
QGGQHLLSQDEWESLFTGASLHLVALKRSFYGSVLFLCRRPAPQDSPVFLSVEDASFRWV
DSLKNILADSSSRPVWLMAVGCTTSGVVGMVNCLRKEPGGHRIRCVLVSNLSSTSPTPEM
DPNSLELQKVLQGDLVMNVYRDGAWGAFRHFPLEKDRPEEQTEHAFINILTRGDLSSIRW
VCSPLRHAQPTGPGVQLCTIYYASLFRDIMLATGKLSPDAIPGKWVARDCMLGMEFSGRD
ARGKRVMGLVPAEGLATSILVSQDFLWDVPSNWTLEEAASVPVVYATAYYALVVRGRMQP
GETVLIHSGSGGVGQAAIAIALSLGCRVFTTVGSAEKRAYLQARFPQLNEASFANSRDTS
FEQHVLWHTAGKGVDLVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSNNHPLGMAIFLK
NVTFHGILLDAIFDDDSATWQEVSALLQAGIRDGVVQPLKCTVFPKTQVEDAFRYMAQGK
HIGKVVLQVREEEQEAVLQGTKPTLMAALSKTYCPAHKTYIITGGLGGFGLELSQWLMLR
GAQKLVLTSRSGIRTGYQARQVREWRRQGVQVLVSTSNASSLDGARSLITATQLGPSGVF
NLAMVLRDAMLENQTPEFFQDVNKPKYNGTLNLDRVTREACPELDYFVVFSSVSCGRGNA
SQTNYGFANSAMERICEKRRHDGLPGLAVQWGAIGDVGVVLETMGTNDIVIGGTLPQRII
SCMEVLDLFLNQPHPVLSSFVLAEKKAAAHGDGSSQQDLVKAVAHIL
Download sequence
Identical sequences ENSTTRP00000008919 ENSTTRP00000008919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]