SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008960 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008960
Domain Number 1 Region: 206-405
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.39e-58
Family Reprolysin-like 0.000000032
Further Details:      
 
Domain Number 2 Region: 422-498
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 2.36e-18
Family Blood coagulation inhibitor (disintegrin) 0.00026
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000008960
Domain Number - Region: 106-123
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0424
Family Recombination endonuclease VII, N-terminal domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008960   Gene: ENSTTRG00000009450   Transcript: ENSTTRT00000009452
Sequence length 810
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3125:521175:535422:-1 gene:ENSTTRG00000009450 transcript:ENSTTRT00000009452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPGYRRARGSPALGLLLLLRLPWPVWGAEAFQGNTPGEPVTLHWVLDGRPRHMVTLEQP
XXKLEVLVVKAEGQELLELKNHRLLAPGYTETHYSPDGQPVVLFPNHTDHCHYHGRVRGF
LDSWVVLSICSGMRGLITLSSNASYYVHPWPAGDSKDFLTHKIFRTEQLLSWKGACGYRD
PGDKRDMARLSCATQIRERRESLGSPRYLELYIVADHTLFLTQHRNLNHTKQRLLEVASY
VDQILRTLDIQVALTGLEVWTEEDQSRVTPDANATLWAFLQWRQGLWARQPHDSAQLLTG
RAFQGATVGLAPVEGMCRESSGGVXXXXXXXXXXAAATMAHEIGHSLGLSHDPDGCCVEA
AAEQGGCVMAAATRHPFPRVFSACSRRQLRAFFSKGGGACLSNAPDSGLLVPRAHCGNGF
VEEGEECDCGAGQECPDSCCHAHNCSLRAGAQCTHGDCCAHCLLKPAGAPCRRSAGDCDL
PEFCTGVSHTYCPPDIYLLDGSPCARXXXXXXXXXXXXXXXQCQQLWGPGSRPAPEACLQ
VVNSAGDAHGNCGQQSDSSFVPCAQSDAQCGKLQCQGGEQSALVPHMVPVDSTVPLGSRQ
VTCKGALVLPGTQLDLPDLGLVESGTQCGPRMVCQERRCRNTTFRELELCLTACHGRGVC
NSNRNCHCALGWAPPFCDKPGFGGSVDSGPMQPENQDTFTLAVILSFLLPLLPGAGLAWC
CCRHPELRLQQCLWGSRRDPTCSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXGRVQKPRSCLW
Download sequence
Identical sequences ENSTTRP00000008960 ENSTTRP00000008960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]