SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008991 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008991
Domain Number 1 Region: 4-191
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.87e-30
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0082
Further Details:      
 
Domain Number 2 Region: 259-409
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000298
Family FAD/NAD-linked reductases, N-terminal and central domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008991   Gene: ENSTTRG00000009486   Transcript: ENSTTRT00000009487
Sequence length 424
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_455:6933:28015:1 gene:ENSTTRG00000009486 transcript:ENSTTRT00000009487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENNEDGLASIYQSAIANTSKEMSCFSDLPMPDFPNFLHNSKFLEYFRIFVKKFDLLKYIQ
FQTTVLSVKKRPDFSTTGQWVVVTESNGKEQSAVFDTVMVCSGHHILPHLPLESFPGIQK
FKGQYLHSHQYKHPEGFERKRILVIGIGNSASDIAVELSKKAAQVFVSTRHGSWVMGRIS
EDGYPWDMVFHTHFSSMLRNVLPRRVVKWVMEQQMNQFNHENYGLMPQNKYLMKPILSDD
LPSHILYGAIKVKSRVKELTETSAIFEDGTVEEDIDVIVFAIGYTFSFPFLEAPLVKVEN
NMVLLYKYMFPPHLEKSTLACIGLIQPLFNFPTVELQARWVTRVFKXXXXXXXXXXXXXX
XXXXXXXXXXXFGESNNQILQTSYIDYLDELALEIGAKPDLLSLLLKEPKLAMKLYFGPC
NSYQ
Download sequence
Identical sequences ENSTTRP00000008991 ENSTTRP00000008991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]