SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008993 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008993
Domain Number 1 Region: 3-219
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.65e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0048
Further Details:      
 
Domain Number 2 Region: 310-483
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000101
Family FAD/NAD-linked reductases, N-terminal and central domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008993   Gene: ENSTTRG00000009489   Transcript: ENSTTRT00000009489
Sequence length 557
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_455:86443:116031:1 gene:ENSTTRG00000009489 transcript:ENSTTRT00000009489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRVAVIGAGVSGLSSIKCCLDEDLEPTCFERSNDIGGLWKFTETSEDGMTRVYKSLVT
NVCKEMSCYSDFPFQEDYPNFMKQEKFWDYLQEFAEHFDLLKYIRFRTTVCSVTKRPDFS
ETGQWDVVTETEGELDRAIFDAVMVCTGHFLNPRLPLESFPGIHKFKGQILHSQEYKIPT
GFQDKRVLVIGLGNTGGDIAVELSRTAAQVLLSTRTGTWVVSRSSNGGYPFNMMDTRRHN
FTAQVLPSCVLKWSRERGLNKRFDHTNYGLNITKGKKPKTIVNDELPTCILCGTVTMKTS
VKEFTETSALFEDGTVEENIDVVIFTTGYTFSFPFLEEPLKSLCTKKTFLYKLVFPSNLE
RTTLAMIGFISLTGSILAGTELQARWATRVFKGLCKIPPSQKLMAEATKKEQLIERGLMK
DTSGDKLDYISYMDELAACIGTKPNVPLLFLKDPRLAWEVFFGPCTPYQYRLMGPGKWDG
ARNAILTQWDRTLKPLKTRIVPDSSKPASMSRYLKAWGAPILLASLLLICKSSLFLKLVP
EKLWDRISPYLVSIWRG
Download sequence
Identical sequences ENSTTRP00000008993 XP_019773935.1.83887 ENSTTRP00000008993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]