SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009009 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009009
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 2.89e-55
Family Globins 0.000000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009009   Gene: ENSTTRG00000009509   Transcript: ENSTTRT00000009508
Sequence length 147
Comment pep:known_by_projection scaffold:turTru1:scaffold_93543:98040:99456:-1 gene:ENSTTRG00000009509 transcript:ENSTTRT00000009508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHFTAEEKAAITGLWGRVNVEEAGGEALGRLLVVYPWTQRFFDNFGNLSSPSAIMGNPK
VKAHGKKVLTSFGDAVKNMDNLKGAFAKLSELHCDKLHVDPENFRLLGNVLVIILASHFG
REFTPELQAAWQKLVAGVATALAHKYH
Download sequence
Identical sequences A0A1K0FUJ2
ENSTTRP00000009009 XP_004329429.1.83887 ENSTTRP00000009009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]