SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009048 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009048
Domain Number 1 Region: 198-417,446-485
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.02e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000744
Further Details:      
 
Domain Number 2 Region: 3-72,100-144
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.00000000994
Family Methicillin resistance protein FemA probable tRNA-binding arm 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009048   Gene: ENSTTRG00000009548   Transcript: ENSTTRT00000009548
Sequence length 538
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2253:89339:105003:1 gene:ENSTTRG00000009548 transcript:ENSTTRT00000009548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLDLDLFRVDKGGDPALIRESQEKRFKDPGLVDQLVKADSAWRRCRFQADNLNKLKNLC
SKTIGEKMKKKEPTGNDESIPEDVLNLDDLTADTLTNLKVSQIKKVRLLIDEAILKCDAE
RIKLEAERFENLREIGNLLHPSVPISNDEDADNKVERIWGXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXGVLVFLEQALIQYALRTLGSRGYTPIYTPFFMRKEVMQEVAQL
SQFDEELYKVIGKGTEKSDDSTYEEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTC
FRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYH
IVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKI
KSNPHLSTQNKLEAMSPLFSPKKVEFVHMLNATMCATTRTICAILENYQTEKGILVPEKL
KEFMPPGLQELIPFVKPAPIDQEPSKKQKKQHEGSKKKGAARDVALESQLQNMEVTDS
Download sequence
Identical sequences ENSTTRP00000009048 ENSTTRP00000009048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]