SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009063 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009063
Domain Number 1 Region: 50-277,306-339
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.76e-41
Family FAD-linked reductases, N-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009063   Gene: ENSTTRG00000009563   Transcript: ENSTTRT00000009563
Sequence length 464
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_399:35372:83241:-1 gene:ENSTTRG00000009563 transcript:ENSTTRT00000009563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPALRYLCSVCGLARGGFPGGFSAACAPKQSKQHLLLCQGGRRASTSSFDVVIIGGGIV
GLASARALILRHPALSIGVLEKEKDLAIHQTGHNSGVIHSGIYYKPESLKAKLCVQGAAL
IYEYCNQKGISYKQCGKLIVAVEQEEIPRLKALYERGLQNGVQDLRLIQQEDIKKKEPYC
RGLMAIDCPHTGIVDYQQVALSFAQDFQEAGGSVLTNFEVEDIKMAKESPSRSKDGMKYP
VVIRNTKGEEVRCQYVVTCAGLHSDRISELSGCNPNPRIVPFRGDYLLLKPEKRYLVKGN
IYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSARDIMDIIIKSGLIK
LVFQNFSYGVNEMYKACFLSATVKHLQKFIPEITISDILRGPAGVRAQALDRDGNLVEDF
VFDGGVGDIGNRILHVRNAPSPAATSSLAISGMIADEVQQRFKL
Download sequence
Identical sequences ENSTTRP00000009063 ENSTTRP00000009063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]