SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009077 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009077
Domain Number 1 Region: 184-526
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-86
Family Protein kinases, catalytic subunit 0.000000262
Further Details:      
 
Domain Number 2 Region: 31-181
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.2e-41
Family Regulator of G-protein signaling, RGS 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009077   Gene: ENSTTRG00000009577   Transcript: ENSTTRT00000009577
Sequence length 589
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2447:243349:257716:1 gene:ENSTTRG00000009577 transcript:ENSTTRT00000009577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELENIVANTVLXXXXXXGGGNRKGKSKKWRQMLQFPHISQCEELRLNIECDYHSLCKRQ
PIGRLLFREFCATRPELTRCIAFLDGVADYEVTPDEKRKECGWRLMQNFLSHTGPDLIPD
VPRQLVTNCAQRLEQGPCKDLFQELTRLTHEYLSVAPYTDYLDSIYFNRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKQILEK
VNSRFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGQAGFPEARAVFYAAEICCGLE
DLHRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVGYMAPEVVKNE
RYTFSPDWWALGCLLYEMIAGQSPFQQRKKKIKREEVERLVKEVPEEYSEHFSPQARSLC
SQLLCKDPAERLGCGGGGAREVKEHPLFKKLNFKRLGAGMLEPPFKPDPQAIYCKDVLDI
EQFSTVKGVELEATDQDFYQKFATGSVSIPWQNEMVETECFQELNVFGLDGSVPPDLDWK
GQPPAPPKKGLLQRLFSRQRTAVGTAATVRKSSPPASSPQPEAPPGGWR
Download sequence
Identical sequences ENSTTRP00000009077 ENSTTRP00000009077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]