SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009233 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009233
Domain Number 1 Region: 115-161,201-465,500-521
Classification Level Classification E-value
Superfamily Clc chloride channel 8.11e-86
Family Clc chloride channel 0.00033
Further Details:      
 
Domain Number 2 Region: 643-804
Classification Level Classification E-value
Superfamily CBS-domain pair 6.57e-27
Family CBS-domain pair 0.00000132
Further Details:      
 
Domain Number 3 Region: 585-645
Classification Level Classification E-value
Superfamily Clc chloride channel 2.75e-17
Family Clc chloride channel 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009233   Gene: ENSTTRG00000009733   Transcript: ENSTTRT00000009740
Sequence length 866
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1492:247701:317642:1 gene:ENSTTRG00000009733 transcript:ENSTTRT00000009740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMT
NGGSISSSTHLLDLLDEPIPGVGTYDDFHTIDWVRERCKDRERHRRINSKKKESAWEMTK
SLYDAWSGWLVVTLTGLASGALAGLIDIAADWMTDLKEGICLSALWYNHEQCCWGSNETT
FEERDKCPQWKTWAELIIGQAEGPGSYIMNYIMYIFWALSFAFLAVSLVKVFAPYACGSG
IPEIKTILSGFIIRGYLGKWTLMIKTITLVLAVASGLSLGKEGPLVHVACCCGNIFSYLF
PKYSTNEAKKREVLSAASAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLWRSFFAALVAA
FVLRSINPFGNSRLVLFYVEYHTPWYLFELFPFILLGVFGGLWGAFFIRANIAWCRRRKS
TKFGKYPVLEVIIVAAITAVAAFPNPYTRLNTSELIKELFTDCGPLESSSLCDYRNDMNA
SKIVDDIPDRPAGLGVYSAIWQLCLALIFKIIMTVFTFGIKXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVTRMTVSLVVIVFEL
TGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRP
RRSDPPLAVLTQDNMTVDDIENMINETSYNGFPVIMSKESQRLVGFALRRDLTIAIESAR
KKQEGIVGSSRVCFAQHTPSLPAESPRPLKLRSILDMSPFTVTDHTPMEIVVDIFRKLGL
RQCLVTHNGSVLGIITKKNMVAHLEELTRRAEPLTPPWYHHKKRYPPSYGPDGKPRPRVH
NVQLSPVTSEGEEAGEEARLLSSTTL
Download sequence
Identical sequences ENSTTRP00000009233 ENSTTRP00000009233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]