SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009343 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009343
Domain Number 1 Region: 184-390
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.37e-47
Family DBL homology domain (DH-domain) 0.00000037
Further Details:      
 
Domain Number 2 Region: 2-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-37
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 
Domain Number 3 Region: 377-539
Classification Level Classification E-value
Superfamily PH domain-like 2e-32
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 
Domain Number 4 Region: 666-767,816-842
Classification Level Classification E-value
Superfamily SH2 domain 2.99e-27
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 5 Region: 588-696
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000106
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 6 Region: 783-831
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000235
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009343   Gene: ENSTTRG00000009827   Transcript: ENSTTRT00000009853
Sequence length 846
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1347:14487:413558:-1 gene:ENSTTRG00000009827 transcript:ENSTTRT00000009853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPWKQCALWLIHCKVLPANHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEI
NLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPV
ALATGIRPFPTEESVNDDDIYKSLPDLIDETRVEDEEGLYDCVYGEDEGGEVYEDLMKAE
EVHQPKCPENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPE
LVKVHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQYCSGVELAISSLDYISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLELVKHTTDPMEKANLKLALDAM
KDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQERH
IFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHIQGQNGLE
FYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHEFKMHTFNRVTSCKVCQMLLRGTFYQG
YLCVKCGARAHKECLGRVDNCGRVNSAEQGTLKPSEKRTNGLRRTPKQVDPGLPKMQAIR
NYTGMPAPALHEGPPLHIQAGDTVELLRGDAHSLFWQGRNLTSGEVGFFPSDAVKPCPCV
PKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKI
LTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSSGQRGNRAG
NSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPST
YVEEDE
Download sequence
Identical sequences ENSTTRP00000009343 ENSTTRP00000009343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]