SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009361 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009361
Domain Number 1 Region: 1263-1464
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-33
Family Pleckstrin-homology domain (PH domain) 0.0000809
Further Details:      
 
Domain Number 2 Region: 888-1107
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-28
Family DBL homology domain (DH-domain) 0.0046
Further Details:      
 
Domain Number 3 Region: 1094-1211
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-22
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009361   Gene: ENSTTRG00000009869   Transcript: ENSTTRT00000009872
Sequence length 1466
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2056:131216:238464:1 gene:ENSTTRG00000009869 transcript:ENSTTRT00000009872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGPKPPIAPKPRLATPSEWRASIYMINSLNKCSNGKLPCVDRGLYDEHRSTPECSKPE
ADEDYIVAPGAPAAEDGPRDGGSVENAVTVPPEASGGEECQERGKECEQEGAAAAEDWAA
PAEAVLGGEDDGGVTPTPENMEVEDCACAPGAEEQKFTSDDEEKQVEEHSVYSLEDGGAG
DGEAVLPSDIILTHLDAEDPAARGEEPRPPVTPGESEEDGEEGRTNTELGASDECVGSDG
PPERDAADGSEEPPENEGLAPGVPEAEVATDSPDVSQEACEDAPGGGGQDGQDEPADQKE
KPDTEATAVVTQEDPVQDEGAEESCQIIPFERDCVDDFVAPLLGRPYEFFPSESTSFCSE
SCSPYSESAQSLESEQEPRSGERAQQDPVAGPGCGRRGSLQGGAGEGPSVPDVVVMPEEE
DAVDDALANPYEMGVGLACGVDPGEEEKPEAQAASGTANGCGLKEEVSSDAEGSLVPIDR
KNVTTRARPHSGKMAGYVPETVPEETGPEAGSSAIGIGGVTKEARKAVLSLEGKPLDVGR
ALPAKPRAFTLYPRSFSVEGREIPMSLCREPEACGLDGHGIKRKDDNLSLPCVIGSSGSF
SQRGHLPSSGTSTPSSVVDIPPPFDLACITKKPITKSSPSLLVESEPPDKHTKKKKPSFK
RFLALTFKKKTESKVHVDVNVSSSRSSSESSYHGPARLLEMDRRSLSNSPQLRARTGKLR
ACDSPSSLIFYRDGKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPNADTSDY
ENIPAMNSDYENIQIPPRRPPRAGTFTKLFEDQSRALSTANENDGYVDMSSFNAFESKQQ
SADQEAESAYTEPYKVCPISAVAPKEDLTSDEERGSSEEEDSAPRDPSLTHKVDGQSRAH
VIAQELLSSEKAYVEMLQHIHLDFHGAVMGALDEMDQEGKDTLAREELRRGLSELPPIRD
LHQGILEELEERLSHWESQQKVADVFLAREQEFEHHAAHIQQFDRYLSLLGENCLHAPRL
AAAVREFEQSQQGGGQNVKHRLLRVQRVQXXXXXXXYLNNLCPDSAEYDNTQGSLTLISK
VTDRANDSMEQGENLQKLVHIEHSVRGQGDLLQPGREFLKEGTLMKVTGKNRRPRHLFLM
SDVLLYTYPQKDGKYRLKNALAVASMKVSRPVMEKVPYALKIETSESCLTLSASSCAERD
EWHSCLSRALPEDSKAQALAAFQHSVEIRERLGVSLGERPPTLVPVTHVMMCMNCGCDFS
LTLRRHHCHACGKIVCRNCSRNKYPLKYLKDRMAKVCDGCYGELKKRGGDIPGLMRGRPV
SMSFPLSSTRFSSSAFSSVFQSINPSAFKKQKKVPSALTEVAASGEGSAISGYLSRCKKG
KRHWKKLWFVIKGKVLYTYMASEDTVALESMPLLGFTIAPEKEEGSSEVGPIFHLYHKKT
VFYSFKAEDTNSAQRWIEAMEDASVL
Download sequence
Identical sequences ENSTTRP00000009361 ENSTTRP00000009361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]