SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009428 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009428
Domain Number 1 Region: 52-392
Classification Level Classification E-value
Superfamily Tryptophan synthase beta subunit-like PLP-dependent enzymes 5.76e-99
Family Tryptophan synthase beta subunit-like PLP-dependent enzymes 0.0000000000104
Further Details:      
 
Domain Number 2 Region: 409-551
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000000134
Family CBS-domain pair 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009428   Gene: ENSTTRG00000009936   Transcript: ENSTTRT00000009941
Sequence length 561
Comment pep:novel genescaffold:turTru1:GeneScaffold_2191:54748:80816:-1 gene:ENSTTRG00000009936 transcript:ENSTTRT00000009941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSETPQAEERSAGCPHLSGAHLGKGSLEKEPPGDKEVLWIRPDAPSRCSWQLGRPATSS
PHRHTALEKSPKILPDILKKIGDTPMVRINKIGRNFGLKCELLAKCEFFNAGGSVKDRIS
LRMIEDAEREGTLKPGDTIIEPTSGNTGIGLALAAAVKGYHCIIVMPEKMSTEKVDVLRA
LGAEIVRTPTNARFDSPESHVGVAWRLRNEIPNSHILDQYRNASNPLAHYDITAEEILQQ
CDXXLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEV
EGIGYDFIPTVLDRTVVDTWFKSNDEDAFAFARMLIAQEGLLCGGSAGSAMSVAVKAAQE
LREEQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEEDLLVKKPWWWHLRVQELSLSAPL
TVLPTVTCEHTIDILREKGFDQAPVVDESGVILGMVTLGNMLSSLLAGKVQPSDQVRKVI
YKQFKQIHLTDPLGKLSHILEMDHFALVVHEQIQSRDLALGMGGPADHSHGESSKRQMVF
GVVTAIDLLNFVAARERNQKT
Download sequence
Identical sequences ENSTTRP00000009428 ENSTTRP00000009428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]