SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009453 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009453
Domain Number 1 Region: 174-329
Classification Level Classification E-value
Superfamily CBS-domain pair 1.06e-41
Family CBS-domain pair 0.000000396
Further Details:      
 
Domain Number 2 Region: 340-478
Classification Level Classification E-value
Superfamily CBS-domain pair 6.41e-32
Family CBS-domain pair 0.00000951
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009453   Gene: ENSTTRG00000009964   Transcript: ENSTTRT00000009967
Sequence length 486
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1416:20002:26647:-1 gene:ENSTTRG00000009964 transcript:ENSTTRT00000009967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPEHALRRTPSWSSLLGPEHQEMSFLEQGDSTSWPSPAMTTSSERSHGEQGTKASRWTRQ
EDVEEGEPPGLGEGLQSRPAAESTGLEATFPKATPWTQAAPLAGVGSPTAEWDILPPDCA
ASASSSSTDDLDVGIEFSATAAWGDELGLVEERPAPCPSPQALLPRLSWDDELQKPGAQV
YMHFMQEHTCYDAMATSSKIVIFDTMLQIKKAFFALVANGVRAAPLWDSKKQSFVGMLTI
TDFILVLHRYYRSPLVQIYEIEEHTIETWREIYLQGSFKPLVSISPSDSLFEAVYTLIKN
RIHRLPVLDPVSGAVLHILTHKRLLKFLHIFGTLLPRPSFLSCTIQDVGIGTFRDLAMVL
ETAPILTALDIFVDRRVSALPVVNEAGQVVGLYSRFDVIHLAAQQTYNHLDVSVGEALRQ
RTLCLEKVVSCQPHETLGEVIDRIVQEQVHRLVLVDETQHLLGVVSLSDILQALVLSPAG
IDALGA
Download sequence
Identical sequences ENSTTRP00000009453 ENSTTRP00000009453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]