SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009454 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009454
Domain Number 1 Region: 39-510
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.07e-127
Family L-arabinose binding protein-like 0.0000000000000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009454   Gene: ENSTTRG00000009970   Transcript: ENSTTRT00000009968
Sequence length 1195
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1818:137474:439049:1 gene:ENSTTRG00000009970 transcript:ENSTTRT00000009968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRLLLVFFPAIFLEMSLLPRGPGRKLLLAGASSQRSVARMDGDVIIGALFSVHHQPPAE
KVPERKCGEIREQYGIQRVEAMFHKLDKINADPVLFTNITLGSEIRDSCWHSSVALEQSI
EFIRDSLISIRDEKDGLNRCLPDGQTLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFNI
PQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESG
MDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLL
SAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLD
TNTRNPWFPEFWQHRFQCRLPGHILENPNFKRICTGNESLEENYVQDSKMGFVINAIYAM
AHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSTFIGVSGEEVWFDEKGDAPGRYD
IMNLQYTEANRYDYVQVGTWHEGVLNIDDYKIQMNKSGMVRSVCSEPCLKGQIKVIRKGE
VSCCWICTACKENEYVQDEFTCKACDVGWWPNADLTGCEPIPVRYLEWSNIESIIAIAFS
CLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQ
RLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTL
VVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPLGYNGLLIMSCTYYAFKTRNVPAN
FNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIA
KPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKPGAGNANFNGKSVSWSEPGG
RQVPKGQHMWHRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYSVEEE
GARPIGFSPPSSPSMVVHRRVPTAVVSTPPLLPRLTAEETPLFLADPAVPRGLPPPLQQP
PPPPPPAQKSLLDQLQGVVNNFSTGIPDFNSVLAVPGAPGNGVRPLFPPPAPPQHLQMLP
LQLSTFGEEPVSPSADDDDEDDSERFRLLQEYLYEREGNTEEDDLGEEGEELRAASKPTP
EDSPALTPPSPFRDSAASGSSAPSSPVSESVLCTPPNATYASVILRDYKQSSSTL
Download sequence
Identical sequences ENSTTRP00000009454 ENSTTRP00000009454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]