SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009466 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009466
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily PH domain-like 4.62e-35
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000009466
Domain Number - Region: 143-242
Classification Level Classification E-value
Superfamily PH domain-like 0.00401
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009466   Gene: ENSTTRG00000009984   Transcript: ENSTTRT00000009980
Sequence length 346
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2558:39603:86595:1 gene:ENSTTRG00000009984 transcript:ENSTTRT00000009980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFIREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKVIPLKMCFAA
RNLSMPDLENRLIELHSPDSRNTLILRCKDTATAHSWFVAIHTNIMALLPQVLAELNAML
GATSTAGGSKEVKHIAWLAEQAKLDGGRQQWRPVLMAVTEKDLLLYDCMPWTRDAWASPC
HSYPLVATRLVHSGSGCRSPSLGSDLTFATRTGSRQGIEMHLFRVETHRDLSTWTRILVQ
GCHAAAELIKEVSLGCTLNGQEVRLTVHYESGFTISRENGGSSSILYRYPFERLKMSADD
GIRNLYLDFGGPEGELTMDLHSCPKPIVFVLHTFLSAKVTRMGLLV
Download sequence
Identical sequences ENSTTRP00000009466 ENSTTRP00000009466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]