SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009610 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009610
Domain Number 1 Region: 232-402
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-48
Family DBL homology domain (DH-domain) 0.000000136
Further Details:      
 
Domain Number 2 Region: 445-584
Classification Level Classification E-value
Superfamily PH domain-like 8.77e-36
Family Pleckstrin-homology domain (PH domain) 0.00000847
Further Details:      
 
Domain Number 3 Region: 129-255
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-21
Family SH3-domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009610   Gene: ENSTTRG00000010138   Transcript: ENSTTRT00000010133
Sequence length 653
Comment pep:novel genescaffold:turTru1:GeneScaffold_3584:97398:142973:1 gene:ENSTTRG00000010138 transcript:ENSTTRT00000010133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAPIDPADQTAAGGCPRGAPRRRPISVIGGVGFYGSSQAEEGEAILPQPAARPPVPAHQV
PPYRAVSARLRPCAFSQSTPIGLDRVGRRRLMRASNISSDGGAESSALADDNGSEEDYSY
EDLCRANPRYLQPGGEQLAINELISDGSVVCAEALWDHVTMDEQELGFKAGDVIQVLEAS
HKDWWWGRSADREAWFPASFVRLRVNQEELAEGSSGTPGEEPAEDAGRGRHKHPESKQQM
RTNVIQEIMDTERVYIKHLRDICEGYIRQCRKHTAMFTVAQLATIFGNIEDIYKFQRKFL
KDLEKQYNQEEPHLSEIGSCFLEHQEGFAIYSEYCNNHPGACAELAGLMKQGRYRHFFEA
CRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTTQEHXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXGQDILERSSELIHSGELTRVTRQGKSQQRTFFLFD
HQLVACKKDLLRRDVLYYRGSTDMDAVELVDLEDGRDGARTLGVRNAFKLVSRTGDEAHL
FCAKKPEDKARWLQACRDERRRVQEDRAMGVEISESQKKLAMLNAQKAGHGKSKGYGGGC
PSAPPLQSLRPVHQRHVTVPASLPQQQVFALAEPKRKPSLFWHTFNKLTPFRK
Download sequence
Identical sequences ENSTTRP00000009610 ENSTTRP00000009610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]