SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009626 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009626
Domain Number 1 Region: 795-912
Classification Level Classification E-value
Superfamily BRCT domain 3.53e-23
Family BRCT domain 0.068
Further Details:      
 
Domain Number 2 Region: 649-723
Classification Level Classification E-value
Superfamily BRCT domain 6.8e-17
Family DNA ligase 0.015
Further Details:      
 
Domain Number 3 Region: 553-645
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000000471
Family DNA ligase 0.079
Further Details:      
 
Domain Number 4 Region: 45-119
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000000847
Family DNA ligase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009626   Gene: ENSTTRG00000010135   Transcript: ENSTTRT00000010149
Sequence length 1017
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2118:6925:47381:-1 gene:ENSTTRG00000010135 transcript:ENSTTRT00000010149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIQLLKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSWVILSVQCGALLP
VNGFSPESCQIFFGITACLSQVSPEDRSALWAMLTFHGGGCQLTLDKKCTHLVVPEPKGX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILQSLAAPTKTLEPQVNHSQQSHANAALL
SQAKVTPESHLSPPAPPSVLHLPPQQALQLQQQPYPPPPHPFRPPPQAHQPQLPPQQQAL
QHQSHTQQLQRLHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXPEEGFLLGCVFAVADYPEQMSDKQLLATWKRIIQAHGGAVDPTFSSRCTHLL
CESQVSGLFAQAVKERKRCVTAHWLNAVLKKKRLVPPHRALHFPVAFPPGGRPCSQHIIS
VTGFVDSDRDDLKLMAYLAGAKYTGYLCRSNTVLICKEPTGLKYEKAKEWRIPCVNAQWL
GDILLGNLEALRQIQYGRYTTFSLQDPFAPAPHLVSNLLDAWRVPLKVSAELLMGVRLPP
KLKQNEAPAVQPSSKRARIEDIPPPTKKLTPELTPFVLFTGFEPVQVQQYIKKLYILGGE
VAESAQKCTHLISSKVTRTVKFLTAISVVKHIVTPEWLEECFKCQKFIDEQSYVLRDAEA
EVLFSFSLEESLRRARVSPLFKAKYFYITPGICPSLSTMKAIVECAGGKVLSKQPSFRKL
MEHTQNKSLSEIILISCENDLHLCREYFARGIDVHNAEFVLTGVLTQTLDYESYKFN
Download sequence
Identical sequences ENSTTRP00000009626 ENSTTRP00000009626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]