SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009640 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009640
Domain Number 1 Region: 150-296,335-350,432-474
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.77e-53
Family Hemopexin-like domain 0.00061
Further Details:      
 
Domain Number 2 Region: 21-63
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000112
Family Somatomedin B domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009640   Gene: ENSTTRG00000010166   Transcript: ENSTTRT00000010164
Sequence length 480
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_752:48930:51985:-1 gene:ENSTTRG00000010166 transcript:ENSTTRT00000010164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPRPLLMLALLAWVVLADQESCKGRCTEGFNSDRKCQCDELCSYYQSCCSDYVVECKP
QLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFVRQAQPEETTEQTPVLNPEE
EAPGPGRGNSEPEVGTVMPETGNLGISESPAEEEQCSGKPFDAFTDLKNGSLFAFRGLYC
YELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDFP
RNISEGFRGIPDNVDAALALPAHSYSGRERVYFFKGRQYWEYEFQQQPSQEECEGSSQSA
VFKHFALLQRDSWEDIFRLLFWGSSSGGAGKPRFISRDWHGLPGQVDAAMAGHIYISGSA
PRSSRTKMTKSARRNRKRYRSRHGRGRGRRRSQNSYRQSRSTWLSWFSSEELGLGDYNYD
NYEMDWLLPANCEPTQSVYFFSGDKYYRVNLRTRRVDAVIPPYPRSIAQYWLGCPVPAHE
Download sequence
Identical sequences ENSTTRP00000009640 ENSTTRP00000009640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]