SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009783 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009783
Domain Number 1 Region: 867-1058
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.11e-62
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000696
Further Details:      
 
Domain Number 2 Region: 54-452
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.12e-54
Family L-arabinose binding protein-like 0.0066
Further Details:      
 
Domain Number 3 Region: 557-850
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-43
Family Protein kinases, catalytic subunit 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009783   Gene: ENSTTRG00000010309   Transcript: ENSTTRT00000010309
Sequence length 1105
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2225:392125:404380:1 gene:ENSTTRG00000010309 transcript:ENSTTRT00000010309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTARALLAGGLRDPGLCAPTREAPSPPGLPRTPSRPRPLLRPLLLLLPPALSAVFTVGVL
GPWACDPIFARARPDLAARLAAARLNHEAALEDGPRFEVALLPEPCRTPGSLGAVSSALT
RVSGLVGPVNPAACRPAELLAQEAGIALVPWGCPGMRAAGTTAPAVTPAADALYALLRAF
RWAHVAVVTAPQDLWVEAGRALSTALRARGLPVALVTSMEPSDLSGAREALRRVQGGPRV
RAVIMVMHSVLLGGEEQRCLLEAAEELGLADGSLVFLPFDTLHYALSPGPDALAVLANSS
QLRKAHDAVLTLTRHCPPGGSVLDSLRRAQEHQELPPDLNLQQVSPLFGTIYDSVFLLAG
GVARARAAAGGGWVSGAAVARHVRDAQVPGFCGALGGAEEPSFVLLDTDAAGDRLFTTYV
LNPTRGFFRSAGTPVHFPRGGRGPGPDPSCWFDPDVICNGGVEPGVVFLGFLLVVLMGLT
GAFLAHYFRHRLLHIQMVSGPNKIILTLDDVTFLPPQRSSSRKVAQESRWSLAARSLSDV
RSIHSQSPDYTNIGLYEGDWVWLKKFPGEQHIAIRPATKMAFSKIRELRHENVALYLGLF
LAGGAGGAAAPGEGMLAVVSEHCARGSLQDLLAQRDIKLDWMFKSSLLLDLIKGIRYLHH
RGVAHGRLKSRNCVVDGRFVLKVTDHGHGRLLEAQRVLPEPPSAEDQLWTAPELLRDPAL
ERRGTLAGDVFSLGIIMQEVVCRSAPYAMLELTPEEMVKRVQSPPPLCRPSVSMDQAPME
CIQLMKQCWAEQPELRPSMDRTFELFKSINKGRKMNIIDSMLRMLEQYSSNLEDLIRERT
EELELEKQKTDRLLTQMLPPSVAEALKMGTPVEPEYFEEVTLYFSDIVGFTTISAMSEPI
EVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMALDILSA
VGTFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIH
VNRSTVEILCALNEGFQTEVRGHTELKGKGCEETYWLVGRRGFDKPIPKPPDLQPGASNH
GISLQSIPPERRQKLEKARPGQFSG
Download sequence
Identical sequences ENSTTRP00000009783 ENSTTRP00000009783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]