SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009858 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009858
Domain Number 1 Region: 11-235
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-59
Family DBL homology domain (DH-domain) 0.0000149
Further Details:      
 
Domain Number 2 Region: 221-362
Classification Level Classification E-value
Superfamily PH domain-like 1.77e-34
Family Pleckstrin-homology domain (PH domain) 0.00067
Further Details:      
 
Domain Number 3 Region: 382-492
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.8e-28
Family DEP domain 0.003
Further Details:      
 
Domain Number 4 Region: 477-602
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.19e-22
Family DEP domain 0.0016
Further Details:      
 
Domain Number 5 Region: 673-739
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000237
Family PDZ domain 0.017
Further Details:      
 
Domain Number 6 Region: 577-669
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000828
Family PDZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009858   Gene: ENSTTRG00000010376   Transcript: ENSTTRT00000010392
Sequence length 1602
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_127:93194:380197:1 gene:ENSTTRG00000010376 transcript:ENSTTRT00000010392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDESRGDGRAESARDLEKQLRLRVCVLSELQKTERDYVGTLEFLVSAFLHRMNQCAASK
LDKNVTEETVKMLFSNIEDILAVHKEFLKVVEECLHPEHNAQQEVGTCFLHFKDKFRIYD
EYCSNHEKAQKLLFELNKIRTIRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLLL
KELLKRTPRKHSDYAAVMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNIT
DTCTEMLMCGVLLKISSGNIQERVFFLFDNLLVYCKRKHRRLKNSKASTDGHRYVFRGRI
NTEVMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKTPEEKHEWFEAILKER
ERRKGLKLGMEQDTWVMISEQGEKLYKMMCKQGNLIKDRKRKLTTFPKCFLGSEFVSWLL
EIGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDGTFYPRNEMQDVIS
KGVRLYCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEAMIFGVGLC
DNGFMHHVEKSEKDELFRFFADEEMEGSNMKHRLMKHDLKVVENVIAKSLLIKSNEGSYG
FGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCLHSRK
PLRVLVSTKPRETVKIPDSAEGLGFQIRGYGPSVVHAVGRGTVAAAAGLHPGQCIIKVNG
INVSKETHASVIAHVTACRKYRRPTKQDSIQWVYNSIESAQEDLQKSNSKPPGDEAEDAF
DCKVEEVIDKFNTMAIIDGKKEHVSLTVDNVHLEYGVVYEYDSTAGIKCNVVEKMIEPKG
FFSLTAKILEALAKSDDHFVQNCTSLNSLSEVIPTDLQSKFSAVCNEKIERICQRISSYK
KVKALCMILQVIIIMYCFIEIMILCNILELVRPTSESFLSLTEGRALNQKVIYMKKNDIQ
LQFSRVLKNRAWPTFKQAKSKISPLHSSDFCPTNCHVNVMEVSYPKTSAYLGSAFGVQKL
SPMVYIQHTITTMAAPSGLSLGQQDGHGLRYLLERKASESIVPTDSDNEKGERNSKRVCF
NVAGDEQEDSGHDTISNRDSYSHSDCNSNRNSVTSFTSICSSQCSSYFHSDEMDSESDEL
PLNVRISRDKQDKIHSCLEHLFSQVDSITNLLKGQAVVRAFEQTKYLTPGRGLQEFQQEM
EPKLSCPKRLRLHIKQDPWNLPSSVRNLAQNIRKFVEEVKCRILLALLEYSDSETQLRRD
MVFCQSLVATVCAFSEQLMAALNQMFDNSKENEMETWEASRRWLDQIANAGVLFHFQSLL
SPNLTDEQAMLEDTLVALFDLEKVSFYFKPSEEEPLVANVPLTYQAEGSRQALKVYFYID
SYHFEQLPLRLKNGGGFKIHPVLFAQALESMEGYYYRDNVLVEEFQAQINAASLEKVKQY
NQKLRAFYLDKSNSPPNSTSKAAYVDKLMRPLNVLDELYRLVASFIRSKRTAACANTACS
ASGVGLLSVSSELCSRLGACHVIMCNSGVHRCTLSVTLEQAIILARSHGLPPCYIMQATD
VMRKQGARVQNTAKNLGVRDRTPQSAPRLYKLCEPPPPAGEE
Download sequence
Identical sequences ENSTTRP00000009858 ENSTTRP00000009858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]