SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009929 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009929
Domain Number 1 Region: 2232-2532
Classification Level Classification E-value
Superfamily BEACH domain 2.09e-107
Family BEACH domain 0.000000000113
Further Details:      
 
Domain Number 2 Region: 176-367
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.62e-33
Family Clostridium neurotoxins, the second last domain 0.028
Further Details:      
 
Domain Number 3 Region: 2120-2227
Classification Level Classification E-value
Superfamily PH domain-like 3.57e-30
Family PreBEACH PH-like domain 0.00000224
Further Details:      
 
Domain Number 4 Region: 2649-2902
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.66e-30
Family WD40-repeat 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000009929
Domain Number - Region: 801-941
Classification Level Classification E-value
Superfamily ARM repeat 0.046
Family Plakophilin 1 helical region 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009929   Gene: ENSTTRG00000010431   Transcript: ENSTTRT00000010467
Sequence length 2915
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2757:56027:640355:1 gene:ENSTTRG00000010431 transcript:ENSTTRT00000010467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGGGSGGGGSGMGELRGASGSGSVVLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRD
IVETVLNLLVGGEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRN
LQTSTEVGLIEQVLLKMSAVDDMIADLLVDMLGVLASYSITVKELKLLFSMLRGESGIWP
RHAVKLLSVLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNN
INVDKDKPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISI
VHIYNRWRNSEIRCYVNGQLVSYGDMAWHVNTNDSYDKCFLGSSETADANRVFCGQLGAV
YVFSEALNPAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAK
ATDAQLCLESSPKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLD
NRQLNDSQVETTVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSRVHITRAV
LEQFLSFAKYLDGLSHGAPLLKQLCDHILFNPAIWIHIPAKVQLSLYTYLSAEFIGTATI
YTTIRRVGTVLQLMHTLKYYYWVINPADSSGIAPKGLXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXRKVEIMHTHSLFTLLGERLMLHTNTVTVTTY
NTLYEILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLS
DMIKLFSNSRENRRCLLQCSVWQDWMFSLGYINPKNSEEQKITEMVYNIFRILLYHAIKY
EWGGWRVWVDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGKKGNVSTISGLSSQ
TTGAKGGMEIREIEDLSQSQSPESETDYPVSTDNRDLLMSTKVSDDILGNSDRPGSAVHV
EVHDLLVDIKAEKVEATEVKLDDMDLSPETLVGAENGALVEVESLLDNVYSAAVEKLQNN
VHGSVGIIKKNEEKDNGPLITLADEKDELPNSSTSFLFDKIPKQEEKLLPELSSNHIIPN
IQDTQVHLGVGDDLGLLAHMTGSVDLTCTSSIIEEKEFKIHTTSDGMSSVSERDLASSSK
GLEYAEMTATTLETESSGSRIVPNIDAGSVISDTERSDDGKESGKEIRKIQTTATTQAVQ
GRSITQQDRDLRVDLGFRGMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFA
LETDVHVWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSP
TVSKTELENIEVTQGMSAETAVTFLSRLMAMVDVLVFASSLNFSEIEAEKNMSSGGLMRQ
CLRLVCCVAVRNCLECRQRQRDRGNKPSHASSKPQEAPQGVTATAASKTPLENVPGNLSP
IKDPDRLLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEPQRETA
RTGSQPGRNIRQEINSPTSTVVVIPSIPHPSLNHGFLAKLIPEQSFAHSFYKETPAAFPD
TVKEKETPAPGEDIHLESSIPHTDSGIGEEQVASILNGAELETGTGPDAMSELLSTLSSE
VKKSQESLTENPSEMLKPAPSISSISQTKGINVKEILKSLVAAPVEIAECGPEPIPYPDP
ALKREAQAILPMQFHSFDRSVVVPVKKPPPGSLAVTTVGAAAAGSGLPTGSTSNIFAATG
ATPKSMINTTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITAKLER
ALEKVAPLLREIFVDFAPFLSRTLLGSHGQELLIEGLVCMKSSTSVVELVMLLCSQEWQN
SIQKNAGLAFIELINEGRLLCHAMKDHIVRVAEAEFILNRQRAEDVHKHAEFESQCAQYA
ADRREEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFWRLDYW
EDDLRRRRRFVRNAFGSTHAEALLKAAIEYGTEEDVVKSKKTFRSQAIVNQNAETELMLE
GDDDAVSLLQEKEIDNLAGPVVLSTPAQLIAPVVVAKGTLSITTTEIYFEVDEDDPAFKK
IDTKVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQATVKKVV
YSLPRVGVGTSYGLPQARRISLATPRQLYKSSNMTQRWQRREISNFEYLMFLNTIAGRTY
NDLNQYPVFPWVLTNYESEELDLTLPGNFRDLSKPIGALNPKRAVFYAERYETWEDDQSP
PYHYNTHYSTATSTLSWLVRIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XELIPEFYYLPEMFVNSNGYNLGVREDEVVVNDVDLPPWAKKPEDFVRINRMALESEFVS
CQLHQWIDLIFGYKQRGPEAVRALNLFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQT
PSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANTLPHLT
IPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDL
VDQSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSES
YIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDYPAPRAVLTGHDHEVVCVSVCAE
LGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSI
NGKLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMD
LSHDQRTLITGMASGSIVAFNIDFNRWHYEHQNRY
Download sequence
Identical sequences ENSTTRP00000009929 ENSTTRP00000009929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]