SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010063 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010063
Domain Number 1 Region: 3-76
Classification Level Classification E-value
Superfamily PWI domain 0.00000523
Family PWI domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010063   Gene: ENSTTRG00000010616   Transcript: ENSTTRT00000010615
Sequence length 680
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2168:38489:55751:1 gene:ENSTTRG00000010616 transcript:ENSTTRT00000010615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTL
RFVDKLFEAVEEGRSSRHSKSSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVE
EEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQLSFISPPTPQPKTPSSSQPER
LPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGI
APPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPTLKANIRAVKREQFKQQLKEK
PSEDMESNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAAR
KTGIHTSTRLALIAPKKELKEGDVPEIEWWDSYIIPNGFDLTEENPKREDYFGITNLVEH
PAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRSNL
MRVLGTEAVQDPTVEAHVRAQMKRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIK
WDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREHFKK
HGAEHYWDLALSESVLESTD
Download sequence
Identical sequences ENSTTRP00000010063 ENSTTRP00000010063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]