SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010074 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010074
Domain Number 1 Region: 213-470
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.75e-72
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000555
Further Details:      
 
Domain Number 2 Region: 472-580
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 9.97e-26
Family Anticodon-binding domain of Class II aaRS 0.001
Further Details:      
 
Domain Number 3 Region: 2-95
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.62e-18
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010074   Gene: ENSTTRG00000010627   Transcript: ENSTTRT00000010626
Sequence length 589
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2168:156615:164628:1 gene:ENSTTRG00000010627 transcript:ENSTTRT00000010626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVWHSSTHVLGAAAERLLGAVLCQGPSTGCGLYHDFFVGKERTIKGSELPVLERICQELA
AAAQPFRRLEASQDQLRQLFKDNPFKLHLIEEKVTGXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAEYTRRGFSEVKTPTLFSTKLWELSGHWE
HYREDMFALQPPDSDSHAGSQSDHSTSHPTGTLALKPMNCPAHCLMFAHRPRSWRELPLR
LADFGALHRAEASGSLGGLTRLRRFQQDDAHIFCAPDQLEAEIRGCLDFLRSVYTVLGFS
FRLALSTRPSGFLGEPCLWDQAEQVLQQALEEFGEPWDLNPGDGAFYGPKIDVHLRDALG
RPHQCGTIQLDFQLPLRFDLQYKGQAGALERPVLIHRAVLGSVERMLGVLAESCGGKWPL
WLSPFQVVVIPVGTEQEEYAREAQRSLQAAGLVGDLDADSGLTLGRRIRRAQLAHYNFQF
VVGQKEQSKRTVNIRTRDNRRLGEWDLAEAVQRLLELQNTRVPNAEEIF
Download sequence
Identical sequences ENSTTRP00000010074 ENSTTRP00000010074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]