SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010130 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010130
Domain Number 1 Region: 21-116
Classification Level Classification E-value
Superfamily Immunoglobulin 9.38e-22
Family C1 set domains (antibody constant domain-like) 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010130   Gene: ENSTTRG00000010685   Transcript: ENSTTRT00000010683
Sequence length 118
Comment pep:novel genescaffold:turTru1:GeneScaffold_616:108640:113041:1 gene:ENSTTRG00000010685 transcript:ENSTTRT00000010683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAFVTLVLLGLLSLSGLDAVQRPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLL
KNGEKMEVEQSDLSFSKDWSFYLLVHAEFTPNAVDKYICRVKHVTLREPKEVKWDRDQ
Download sequence
Identical sequences ENSTTRP00000010130 ENSTTRP00000010130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]