SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010148 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010148
Domain Number 1 Region: 509-541,617-691
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000116
Family Anti-sigma factor antagonist SpoIIaa 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010148   Gene: ENSTTRG00000010702   Transcript: ENSTTRT00000010702
Sequence length 723
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_668:62434:93648:-1 gene:ENSTTRG00000010702 transcript:ENSTTRT00000010702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHVEETEILAATQRYYVERPIFSHPVLQERLHKKDKISESIGDKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYRFKEYVLGDIVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPV
IMYCFFGTSRHISIGPFAVISLMIGGVAVRLVPDDIVIPGGVNATNSTEARDALRVKVAM
SVTLLTGIIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMG
TGISAGFSLHESYNVDVVGTLPLLLVIDTLFHVYDIIAIDSVIMKTAHYSNGNQELIALG
LCNSTGSLFQTFAISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAV
LSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALMTV
IYRTQSPSYIVLGQLPDTDVYIDIDAYEEVKEVPGIKIFQINAPIYYANSDLYSSALKRK
TGVNPAFILGARRKAMKKYAKEVGNANMANATVVKVTDAEVDAEDGTKPEEEEDEIKYPP
IVTKSTLPEELQRFMPPGDNVHTIILDFTQVNFMDSVGVKTLAGIVKEYGDVGIYVYLAG
CSAQVVSDLTQNQFFENPALLDLLFHSIHDAVLGSQVREALAEQEATAAPPQEDSEPNAT
PEA
Download sequence
Identical sequences ENSTTRP00000010148 ENSTTRP00000010148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]