SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010156 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010156
Domain Number 1 Region: 143-460
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.54e-121
Family Transglutaminase core 0.000000000119
Further Details:      
 
Domain Number 2 Region: 2-140
Classification Level Classification E-value
Superfamily E set domains 1.4e-42
Family Transglutaminase N-terminal domain 0.00000944
Further Details:      
 
Domain Number 3 Region: 483-595
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.71e-28
Family Transglutaminase, two C-terminal domains 0.00000407
Further Details:      
 
Domain Number 4 Region: 595-693
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.94e-25
Family Transglutaminase, two C-terminal domains 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010156   Gene: ENSTTRG00000010706   Transcript: ENSTTRT00000010710
Sequence length 694
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1158:11195:53453:1 gene:ENSTTRG00000010706 transcript:ENSTTRT00000010710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALGLQSVDWQISLNEQAHHTDKFSSQELVVRRGQLFYMSLTVYRCLGCNRSATFTAST
GPYPSESAKTKAVFPLSNRISGTGWGAQLLNNKNNVLSISILSPADAPIGRYTLSIEISY
EGNDSTTEVGTFILLFNPWLQADSVFMSNHDEREEYVQEDAGVIFVGRTSYISKIGWNYG
QFEEGILNICLSLLDNSLNFRRDPATDVARRDDPQYIGRVLSAMINANDDYGVISGNWSG
NYVGGQDPRNWNGSVEILKQWQSSGFRPVRYGQCWVFAGTLNTALRCLGIPSRVITNFNS
AHDTDKNLSVDVYYDPRGWPMDKGSDSVWNFHVWNEGWFARTDLSPSYSGWQVLDATPQE
RSQGVFQCGPASVVALREGNVDWDYDMPFIFAEVNADRITWIYDAWTGALKKNFSNTHTI
GKNISTKAVGSNSRMDVTENYKYPEGSSQERQVFEKALGKLQPSMSLHATSARVFSREER
QPSISGKFKITDILTVGKEVNMALVLRNLTGDSKTVTVNMTAWTIVYNGTLVHEVWKESV
TLSLGPNEEIQHPVKIAYALYKKYLKADNMIRATAVCEISDETEVVVERDIILENPTLTL
EVLDQARVQKPVTVQILFSNPLDELVKDCKLIAEGSGLLQGTLEIDMPNLSPREQSQVDF
EILPTRSGTKQLLVNLSCNKFSAIKGMLPIKVVD
Download sequence
Identical sequences ENSTTRP00000010156 ENSTTRP00000010156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]