SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010184 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010184
Domain Number 1 Region: 265-341
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-20
Family SH3-domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010184   Gene: ENSTTRG00000010730   Transcript: ENSTTRT00000010742
Sequence length 342
Comment pep:known_by_projection scaffold:turTru1:scaffold_115349:86956:131427:-1 gene:ENSTTRG00000010730 transcript:ENSTTRT00000010742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNPIPSNLKSEAKKAAKILREFTEITSGSGPDKIIPAHVIAKAKGLVVLSAIKAGFLVT
ARGGSGIVLARLPDGKWSAPSAIGIAGLGGGFELGIEVSDLVIILNYDRAVEAFAKGGNL
TLGGNLTVAVGPLGRNLEGDVSLRSSAAVFTYCKSRGLFAGMSLEGSCLIERKETNRKFY
CQDIRAYDILFGDIPRPAEAEDLYEILDSFTEKYENEGQRINARKAARERKKASAKELPS
KPLSRPRQSSAQAQLNSGSQSNRNEYNLYPELSSYRERVGNLNQPLEVTALYSFEGQQPG
DLNFQAGDRITVISKTDSHFDWWEGNLRGQTGIFPANYVTMN
Download sequence
Identical sequences ENSTTRP00000010184 ENSTTRP00000010184 XP_019798905.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]