SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010187 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000010187
Domain Number - Region: 309-418
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0194
Family Regulator of G-protein signaling, RGS 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010187   Gene: ENSTTRG00000010750   Transcript: ENSTTRT00000010745
Sequence length 421
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1407:8016:25198:1 gene:ENSTTRG00000010750 transcript:ENSTTRT00000010745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNAEMIGSTNLIFLLEDETFADFFNTFLSLLVFGQTPFYTLENSWSLWPEIPHDLIAKY
KGLLTWLEKYRLPFFCKTNLWFHYILCQEFISFVQSPEGEALLNSVWHPNQSTIRREILS
HKQKVALFKLQSYWLPNFYTHAKTIMAKEESCQALMQEYETRLYSICYTHVGGLPLSMSI
KKGHHPQKRYSSGKAKRKMWQLTDQGSWSLEVNTNPDTNTLLPQELFPQGKLVIQMPSPK
ETSLKVRIISFQEEDILCAKKSNVKNKAKSHLHMEGLFETSFFTHLRTVTPIINYSPHMT
IKKAMEQNLSLGYTHWALCADACAGSPFRDHLKKQNLKVGVQLLDLWQDLHDFLSVLMSN
RKTGKAIFWHMLGNRICELYLNEQIGLRLPLKSQTIKGLKELLPSGDVNLWIPRAQKEIC
N
Download sequence
Identical sequences ENSTTRP00000010187 ENSTTRP00000010187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]