SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010226 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010226
Domain Number 1 Region: 334-592
Classification Level Classification E-value
Superfamily Clc chloride channel 8.11e-46
Family Clc chloride channel 0.0009
Further Details:      
 
Domain Number 2 Region: 99-284
Classification Level Classification E-value
Superfamily Clc chloride channel 3.53e-40
Family Clc chloride channel 0.0023
Further Details:      
 
Domain Number 3 Region: 594-671,788-859
Classification Level Classification E-value
Superfamily CBS-domain pair 3.4e-29
Family CBS-domain pair 0.0000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010226   Gene: ENSTTRG00000010779   Transcript: ENSTTRT00000010784
Sequence length 983
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2937:28836:63665:1 gene:ENSTTRG00000010779 transcript:ENSTTRT00000010784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSGSQRHGAEPSWWGSAPQYQYMPFEHCTSYGLPSKSGGLQHRLRRDAGSRPNARPTQ
IYGHHKAQFSDNEQDTGMPKTMDSSASMDSTEEDHYSKCQGCIHRLGLVMRRKLGEDWIF
LLLLGLLMALVSWCMDYVSAKTLQAYKWTYYQMQPNLPLQFLVWVSFPLVLILFSALFCH
LISPQAVGSGIPEMKTILRGVVLKEYLTLKAFVAKVVALTAGLGSGIPVGKEGPFVHIAS
ICAAVLSKFMSVLCGVYEQPYYYTDMLTVGCAVGVGCCFGTPLGXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXTITALFRTNFRMDFPFDLQELPAFAAIGICCGF
LGAVFVYLHRQVMLGVRKHKALSQFLAKHRLLYPGIVTFVIASFTFPPGMGQFMAGELMP
REAISTLFDNNTWVKHEGDPESLGQSAVWIHPKVNVVIIIILFFIMKFWMSIVATTMPIP
CGGFMPVFVLGAAFGRLVGEIMAILFPDGILFDDIIYKILPGGYAVIGAAALTGAVSHTV
STAVICFELTGQIAHILPMMVAVILANMVAQSLQPSLYDSIIQVKKLPYLPDLGWNQLSK
FTVFVEDIMVRDVKFVSASCTYGELRNLLQTTTVKTLPLVDSKDSMILLGSVERSELQSL
LQHHLCPERRLQLAQDMARKLSELPFDGKVRQVGEGRRGPGRPESFAFVDEDEDEDLYGK
PELPPLPPPHPFSTAPLPPEEPNGPVPGHKQQLEAPELEGQRPSIFQSLLRCLLGRARPT
KKMTQDSEDLVDNMSPEEIEAWEREQLSQPVCFDSCCIDQSPFQLVEQTSLHKTHTLFSL
LGLHLAYVTSMGKLTGVLALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXKKKMVL
Download sequence
Identical sequences ENSTTRP00000010226 ENSTTRP00000010226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]