SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010234 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010234
Domain Number 1 Region: 362-512
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-36
Family DBL homology domain (DH-domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010234   Gene: ENSTTRG00000010796   Transcript: ENSTTRT00000010793
Sequence length 785
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2940:47889:54060:1 gene:ENSTTRG00000010796 transcript:ENSTTRT00000010793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQSLPAATPPTQKPPRIIRPRPPSRPRAAQSPGAHHNGSSPQEPPLTANEAPTLMCTP
IFWEPPASSLKPPALLPPSASKASLDSQTSPDSPSGTPSPVSRRSISPEPAPRSPVPPPK
PSGSPRTALPLLHSTRAPGQDGSASAAGTVRRLAGRFEWGVEGKVQAPDALEPGSPGGPD
VNGERETAQGILAGSGSQENGTPDAALACPACCPCVCHVARPGLELRWVPLGGYEDGPRV
PCRASPLRTSRSRPSPPSLGQPPVVLTSYRSTAERKLLPPLKPPKPTRVRQDVTSSGDAP
QPDLDLPSEDGIQTGDSPDGVPQNDPPATTEGREAEELEELKGQNWELPLQDAHAGGGCL
GRARSLFEVVTSEASYLRSLRLLTDTFVLSQALRDTLTPRDHHTLFSNVQRVQGVSERFL
GKLLSRVRSSPHISDLCDVVHAHAVGPFSVYVDYVRNQQYQEETYSRLMDTNVRFSAELR
RLQSLPKCQRLPLPSFLLLPFQRITRLRMLLQXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXWLKGLPGAFPAQLVCEVTGEHERRKHLRQHQRLLEAVGSSSGSP
SAPQP
Download sequence
Identical sequences ENSTTRP00000010234 ENSTTRP00000010234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]