SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010238 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010238
Domain Number 1 Region: 435-709
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.2e-38
Family Lysophospholipase 0.049
Further Details:      
 
Domain Number 2 Region: 136-218
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000589
Family cAMP-binding domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010238   Gene: ENSTTRG00000010778   Transcript: ENSTTRT00000010797
Sequence length 809
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2453:19449:54785:-1 gene:ENSTTRG00000010778 transcript:ENSTTRT00000010797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQEGDAGPELVVVATEILLALALVGGLSLFVYRSVNFRQGQPTPQYRFRERDKAMLYGR
NSMRKVTTLPHALVGNTAAPRQQARKRTKVLSLAKSILRFKQEYPTLQPKEPPPSLLEAD
LTEFDVKNSHLPSEVLYMLKNVRVPGHFEKPLFLELCKHMVFVLLEGEYVFRPGEPDTSI
YVVQDGRLEVCIQDSVVTLIHLLGEKILVILQQGTATGHQFGLHAVGSKWDSGNPASNLS
TVAVMPVSEDVPLTTFTLELKHALSAIGPALLLTSGNVKQRLVSAALDSIHEHRLSSWLG
QQEDIHRIVLYQVDSTLTPWTQRCIRQPDFILIVGLGEVSRGASAGGLERVLESAAVRAQ
KRREDGPAPARTVQRLSLGCCSGHLHPCCPRRVTRRSLPELVEPSERVCQRPPDRRSDFS
GLARVLTSNAVALVPGGGARGCAQVGIIRALTEGGIPAHVLGSTRAFTGALCSEEWNYSQ
IRIRAKQWAEDVMSMVKTMLDLTYPIPSVFVFSGAGCSRSICSVFKDRQIEDLWVPYFTI
TTDITASAMRVHTDGSLWRYVRASMSLSGYMPPLCNPKDGHLLIDGGSINNLPADVARSM
GAKVVIAIDMGSRDETDLTNYGDALSRWWLLWKRWNPLATKVKVLDMVEIQTRLAYVCCV
RQLEMVKSSDYCEDLRPPPPNSYGTLDFSKFDEICEVGYQHGRTVFDIWGRSGMLEKMLQ
DRGTSKVKACDVLTCPNASFMDLTEIVSRIEPAKVAAADDESDHQTEYKEVLLGSPDLGS
DSEDKPSLWPRHSRLASPEPSQDSSDQDG
Download sequence
Identical sequences ENSTTRP00000010238 ENSTTRP00000010238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]