SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010249 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010249
Domain Number 1 Region: 149-198
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00000000628
Family MYND zinc finger 0.01
Further Details:      
 
Domain Number 2 Region: 44-88
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00000388
Family Intron-encoded homing endonucleases 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010249   Gene: ENSTTRG00000010812   Transcript: ENSTTRT00000010808
Sequence length 210
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2453:76927:85234:-1 gene:ENSTTRG00000010812 transcript:ENSTTRT00000010808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKYTLIDEQDIPLVEGYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERHR
GGIAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPGAEETSSKQREQSLYWLAIQQLPTDPI
EEQFPVLNVTRYYNANGDVVEEEETSCTYYECHYPPCTMMEKQLREFNICGRCQVARYCG
SQCQQKDWPAHKKHCREKRRPFQHELEPER
Download sequence
Identical sequences ENSTTRP00000010249 ENSTTRP00000010249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]