SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010281 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010281
Domain Number 1 Region: 50-465
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.96e-77
Family L-arabinose binding protein-like 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000010281
Domain Number - Region: 10-20
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000732
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 781-822
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0602
Family Mitotic arrest deficient-like 1, Mad1 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010281   Gene: ENSTTRG00000010841   Transcript: ENSTTRT00000010841
Sequence length 940
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1470:426844:795555:-1 gene:ENSTTRG00000010841 transcript:ENSTTRT00000010841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPPSSGQPGPPPPPPPPPARLLLLLLLPLLLPLAPGAWSARGVPRPPPSSPPLSIMGL
MPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAI
KYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNA
VNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVK
KLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSSR
CLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDG
IWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGE
RMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIKFQGSEPPKDKTIVLEQLRKISLPL
YSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLDG
SFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVIV
GGMLLIDLCILICWQAVDPLRRTVERYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIVY
AYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQF
CIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSVN
QASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNLG
NFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILHH
AYLPSIGGVDASCVSPCVSPTASPRHRHVPPSFRVMVSGL
Download sequence
Identical sequences ENSTTRP00000010281 ENSTTRP00000010281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]