SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010359 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010359
Domain Number 1 Region: 279-514
Classification Level Classification E-value
Superfamily PRTase-like 1.01e-61
Family Phosphoribosyltransferases (PRTases) 0.00000782
Further Details:      
 
Domain Number 2 Region: 12-286
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 9.44e-57
Family Class II glutamine amidotransferases 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010359   Gene: ENSTTRG00000010928   Transcript: ENSTTRT00000010927
Sequence length 517
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2123:191256:226565:-1 gene:ENSTTRG00000010928 transcript:ENSTTRT00000010927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGNSIPT
FKTHKGMGLVNHVFTEDNLKKLYTSNLGIGHTTYATKGNCELENCQPFVVETLHGKIAVA
HNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEA
PTAYSLIIMHRDVIYAVRDPYGNRPLCIGRLIPVSDINDKEKKSSETEGWVVSSESCSFL
SIGARYYREILPGEIVEISRHNIQTLDIIPRSEGNPMAFCIFEYVYFARPDSIFEDQMVY
TVRYRCGLQLAIEAPVDADLVSTVPESATPAALGYAAKCELPYVEVLCKNRYVGRTFIQP
NMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASP
PIRYPCFMGINIPTKEELIANKPEFEHISDHLGANSVVYLSVEGLVASVQEGITFKKQKV
KRQDIMVQENGNGLECFEKNGHCTACLTGKYPVELEW
Download sequence
Identical sequences ENSTTRP00000010359 ENSTTRP00000010359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]