SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010384 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010384
Domain Number 1 Region: 249-469
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.9e-54
Family DBL homology domain (DH-domain) 0.0000854
Further Details:      
 
Domain Number 2 Region: 460-596
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-18
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000010384
Domain Number - Region: 641-667
Classification Level Classification E-value
Superfamily SH3-domain 0.00461
Family SH3-domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010384   Gene: ENSTTRG00000010953   Transcript: ENSTTRT00000010952
Sequence length 705
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1412:317029:392690:-1 gene:ENSTTRG00000010953 transcript:ENSTTRT00000010952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METRDSADLGKPQKKSVSGSWEIGELASVRPEVLSEEGTPHANQEMQDKAPHYYIPIQRN
SIFNRTVRHRSKGKARGTPEQNCGHLADSLENGNSVNEPLNLNFPQSRTRPWRIPTRTDL
GAKRASESSSTLGNEATPEECPALDSPTTLTEALQMIHPIPSDSWRNLIEQIGLLYQEYR
DKSTLQEIETRRQQDAEIQDNADGSPASVETPEEDEGEEEEPASPPERKAVPQICLLSNP
HSRFNLWQDLPEIRSSGVLDILQPEEIRLQEAMFELVTSEASYYKSLNLLVSHFMENERL
KKILHPSEAHILFSNVLDVMAVSERFLLELERRMEENIVISDVCDIVYLYAADHFSVYIT
YVSNQTYQERTYKQLLQEKAAFRELITQLELDPKCRGLPLSSFLILPFQRITRLKLLVQN
ILKRVEERSEREGTALGAHKELELVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIIS
HSRWLLKQGELQQMSGPKTSRTLRTKKLFREIYLFLFNDLLVICRQIPGDKYQVFDSAPR
GLLRVEELEDQGQTLANVFILRLLENADDREATYMLKASSQSEMKRWMTSLAPNRRTKFV
SFTSRLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWIFGERLHDQERGWFPS
SMTEEILNPKIRSQNLKECFRVHKMDDPQRSQNKDRRKLGSRNRQ
Download sequence
Identical sequences ENSTTRP00000010384 ENSTTRP00000010384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]