SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010419 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010419
Domain Number 1 Region: 163-412
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.13e-59
Family Voltage-gated potassium channels 0.00055
Further Details:      
 
Domain Number 2 Region: 37-134
Classification Level Classification E-value
Superfamily POZ domain 3.4e-27
Family Tetramerization domain of potassium channels 0.00000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010419   Gene: ENSTTRG00000011019   Transcript: ENSTTRT00000010993
Sequence length 495
Comment pep:known_by_projection scaffold:turTru1:scaffold_109875:197863:199350:-1 gene:ENSTTRG00000011019 transcript:ENSTTRT00000010993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVMSGENVDEASAAPGHPQDGSYPRPAEHDDHECCERVVINISGLRFETQLKTLAQFPN
TLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFY
ELGEEAMEKFREDEGFIKEEERPLPDKEYQRQVWLLFEYPESSGPARVIAIVSVMVILIS
IVIFCLETLPELKDDKDFTGTVHRLDNTTVVYSVNIFTDPFFIVETLCIIWFSFELVVRF
FACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVF
RIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIP
DAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE
GEEQAQLLHVSAPNLASDSDLSRRSSSTISKSEYMEIEEDVNNSIAHFRQANVRTGNCTT
ADQNCVNKSKLLTDV
Download sequence
Identical sequences ENSTTRP00000010419 XP_004323680.1.83887 ENSTTRP00000010419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]